Tesamorelin + Ipamorelin (8mg)

Additional Info

Properties

• Tesamorelin Chemical Formula: C223H370N72O69S
• Ipamorelin Chemical Formula: C38H49N9O5
• Tesamorelin Molecular Weight: 5195.908 g/mol
• Ipamorelin Molecular Weight: 711.868 g/mol
• Tesamorelin Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
• Ipamorelin Sequence: Aib-His-D-2Nal-D-Phe-Lys
• Total Amount of the Active Ingredient: 8mg (1 vial)
• Shelf Life: 36 months

Shipping

• USA
• Canada
• Seizure Policy (International Orders): If your shipment is seized, we offer a 50% discount on your next purchase. Contact us for details.

Disclaimer

The information provided is not a substitute for medical advice, diagnosis, or treatment. Always consult your physician or qualified healthcare provider regarding medical conditions. Never delay or disregard medical advice based on information obtained here. We assume no responsibility or liability for any use of our research compounds and products. These are sold strictly for research purposes and are not intended for personal use.

Additional Label and Product Information

Essential Warning:

These chemicals are for research or laboratory use only and are not FDA approved for human consumption.

Instructions for Use:

• Avoid contact with skin and eyes; wash with water if contact occurs.
• Seek medical attention if feeling unwell or accidental ingestion occurs.
• Store the lyophilised (freeze-dried) peptide at room temperature upon receipt.
• Avoid frequent freeze-thaw cycles to maintain peptide stability.

Product Disclaimer

This product is not intended to diagnose, treat, cure, or prevent any disease. Use only as directed by your specific research or laboratory protocol.

Resources

• Clinical Review Report: Tesamorelin (Egrifta)
  • Published by the Canadian Agency for Drugs and Technologies in Health in August 2016, this report provides an introduction to Tesamorelin.
  • Access the report at Clinical Review Report: Tesamorelin.
• Ferdinandi, E. S., Brazeau, P., High, K., Procter, B., Fennell, S., & Dubreuil, P. (2007). Non-clinical pharmacology and safety evaluation of TH9507
  • This study in Basic & Clinical Pharmacology & Toxicology discusses TH9507, an analogue of human growth hormone-releasing factor.
  • DOI: 10.1111/j.1742-7843.2007.00008.x.
• Johansen, P. B., Nowak, J., Skjaerbaek, C., Flyvbjerg, A., Andreassen, T. T., Wilken, M., & Orskov, H. (1999). Ipamorelin, a new growth-hormone-releasing peptide
  • This article from Growth Hormone & IGF Research explores Ipamorelin’s effect on longitudinal bone growth in rats.
  • DOI: 10.1054/ghir.1999.9998.
• Spooner, L. M., & Olin, J. L. (2012). Tesamorelin: a growth hormone-releasing factor analogue for HIV-associated lipodystrophy
  • Published in The Annals of Pharmacotherapy, this article discusses Tesamorelin’s use for HIV-associated lipodystrophy.
  • DOI: 10.1345/aph.1Q629.
• Hou, F., Zhang, H., Cong, Z., Zhao, L. H., Zhou, Q., Mao, C., Cheng, X., Shen, D. D., Cai, X., Ma, C., Wang, Y., Dai, A., Zhou, Y., Sun, W., Zhao, F., Zhao, S., Jiang, H., Jiang, Y., Yang, D., Eric Xu, H., … Wang, M. W. (2020). Structural basis for activation of the growth hormone-releasing hormone receptor
  • This article in Nature Communications provides insights into the structural activation of the growth hormone-releasing hormone receptor.
  • DOI: 10.1038/s41467-020-18945-0.
• Raun, K., Hansen, B. S., Johansen, N. L., Thøgersen, H., Madsen, K., Ankersen, M., & Andersen, P. H. (1998). Ipamorelin, the first selective growth hormone secretagogue
  • European Journal of Endocrinology publishes this study on Ipamorelin, highlighting its selective action as a growth hormone secretagogue.
  • DOI: 10.1530/eje.0.1390552.
• Jiménez-Reina, L., Cañete, R., de la Torre, M. J., & Bernal, G. (2002). Influence of chronic treatment with the growth hormone secretagogue Ipamorelin
  • This study in Histology and Histopathology investigates Ipamorelin’s effects on somatotroph response in young female rats.
  • DOI: 10.14670/HH-17.707.
• Andersen, N. B., Malmlöf, K., Johansen, P. B., Andreassen, T. T., Ørtoft, G., & Oxlund, H. (2001). The growth hormone secretagogue Ipamorelin
  • Published in Growth Hormone & IGF Research, this article examines Ipamorelin’s counteractive effects on glucocorticoid-induced bone formation decrease in adult rats.
  • DOI: 10.1054/ghir.2001.0239.
• Svensson, J., Lall, S., Dickson, S. L., Bengtsson, B. A., Rømer, J., Ahnfelt-Rønne, I., Ohlsson, C., & Jansson, J. O. (2000). The GH secretagogues ipamorelin and GH-releasing peptide-6
  • This article in The Journal of Endocrinology reports on Ipamorelin and GH-releasing peptide-6’s ability to increase bone mineral content in adult female rats.
  • DOI: 10.1677/joe.0.1650569.